MG_100_MONOMER – glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit

Name
WID MG_100_MONOMER View in model
Name glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit View in model
 
Genetics
Gene MG_100 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MINFEAIIGIEVHVVLNTASKMFSKAPNRVDNQKINHFIDPIDLGLPGTL
PQVNELAVYKALLLADALKMKTVTNKLVFDRKHYFYQDLPKGFQITQQNY
PFAKNGVVTINVDAIEKPIYIDRFHLEEDTAKQHFNHDQILLDFNRCGAP
LIEVVTLPVINTAKEAKAYLQKLRQILIVNNISNAKLEDGSMRSDCNVSV
RLKGQRQLGTKIEIKNINSLNNVEKAIDLEINRQVKALINGETLSQATLS
FDDKTNNNVFMRKKDNTIDYRYFIEPNIMTSNIDDLLLEKPVAFQLEQFQ
KELIDSNVNPQLVQLVVDDATIFSAFQTINSVIKNPQETIRWLCIELIGQ
LNKTNSSLTANLIQDLITLIEMLKAAKVNQKQAKQLITLMIETKKDPKSL
AKLHNLEQITDPKELQKIIKKIFQENEKEILKNIDRIERIQKLIIGQVMH
KTNNRANPQQVFIIVENMLHEVRERDS*
50
100
150
200
250
300
350
400
450
478
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3989C2446N668O721S13
Molecular weight (pH 7.5; Da) 54707.57 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
17795
Instability index 37.56
Is stable True
Aliphatic index 108.49
GRAVY (25C, pH 7.0) -0.284
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase
[c]: MG_098_MONOMER + MG_099_MONOMER + MG_100_MONOMERMG_098_099_100_TRIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_098_099_100_TRIMER).
 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26