MG_097_MONOMER – uracil-DNA glycosylase, putative

Name
WID MG_097_MONOMER View in model
Name uracil-DNA glycosylase, putative View in model
Cross references PDB: 1LQM, PDB: 5EUG
 
Genetics
Gene MG_097 View in model
 
Structure
Sequence
1
51
101
151
201
VVMDDLFQRMVSCVLPSWRAFIDEEVKKPYFQALLEKLKALKATIIPKPE
LIFRVFSFFKPIDTKVIIFGQDPYPSPNDACGLAFASNNSKTPASLKRII
LRLEKEYPSLKQESSWQQNFLLNWAEQGVLLLNGILTTTVFIRNAHKNWG
WEEFNCNLLTFLKNQNIKPLLVFLGVQTKNFVVKSIGNVDGFEHLSYPHP
SPLSGNLFLTNPNDLFKTINNWLKQHNQKIINWAVVKNASFDQLS*
50
100
150
200
246
View in model
Is N‑terminal methionine cleaved
No
View in model
DNA footprint Length: 9 (nt), Binding: dsDNA, Region: dsDNA View in model
Empirical formula (pH 7.5) H2022C1308N333O350S5
Molecular weight (pH 7.5; Da) 28172.32 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
44835
Instability index 26.36
Is stable True
Aliphatic index 98.25
GRAVY (25C, pH 7.0) -0.108
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Reaction participant View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0075]. DNA-binding Fpg footprint is 9 nt [PUB_0719]. Ogg1 footprint is 10 nt [PUB_0719, PUB_0720, PUB_0721, PUB_0722]. Mpg footprint is 12 nt [PUB_0717].
References
  1. Bruner SD, Norman DP, Verdine GL. Structural basis for recognition and repair of the endogenous mutagen 8-oxoguanine in DNA. Nature 403, 859-66 (2000). WholeCell: PUB_0721, PubMed: 10706276

  2. Fromme JC, Bruner SD, Yang W, Karplus M, Verdine GL. Product-assisted catalysis in base-excision DNA repair. Nat Struct Biol 10, 204-11 (2003). WholeCell: PUB_0720, PubMed: 12592398

  3. Miao F, Bouziane M, O'Connor TR. Interaction of the recombinant human methylpurine-DNA glycosylase (MPG protein) with oligodeoxyribonucleotides containing xsDNA hypoxanthine or abasic sites. Nucleic Acids Res 26, 4034-41 (1998). WholeCell: PUB_0717, PubMed: 9705516

  4. Norman DP, Bruner SD, Verdine GL. Coupling of substrate recognition and catalysis by a human base-excision DNA repair protein. J Am Chem Soc 123, 359-60 (2001). WholeCell: PUB_0722, PubMed: 11456534

  5. Sidorenko VS, Zharkov DO. Correlated cleavage of damaged DNA by bacterial and human 8-oxoguanine-DNA glycosylases. Biochemistry 47, 8970-6 (2008). WholeCell: PUB_0719, PubMed: 18672903

  6. Varshney U, Hutcheon T, van de Sande JH. Sequence analysis, expression, and conservation of Escherichia coli uracil DNA glycosylase and its gene (ung). J Biol Chem 263, 7776-84 (1988). WholeCell: PUB_0075, PubMed: 2836397

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26