MG_094_MONOMER – replicative DNA helicase

Name
WID MG_094_MONOMER View in model
Name replicative DNA helicase View in model
Cross references PDB: 1JWE
 
Genetics
Gene MG_094 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MGQQTSFKYANDSNIERAERRLMQAVAQNSEGIDLIFNKLEPIDFFATPF
KLIFQTAKENYQLNNPIIGSGLLEAVKFKLDANDQSTKSELEILFTKILL
IRLPPNQTEIKTLVDVVKKASIFRRLQQFAKRVYNEEFKLKEDRFEGYLQ
AIQDDFVKIIHSAFSNIFAFSYDEIANQEEALIKKVHRGELIISGLSSGF
LKLDQLTSGWKPGELIVIAARPGRGKTALLINFMASAAKQIDPKTDVVLF
FSLEMRNREIYQRHLMHESQTSYTLTNRQRINNVFEELMEASSRIKNLPI
KLFDYSSLTLQEIRNQITEVSKTSNVRLVIIDYLQLVNALKNNYGLTRQQ
EVTMISQSLKAFAKEFNTPIIAAAQLSRRIEERKDSRPILSDLRESGSIE
QDADMVLFIHRTNDDKKEQEEENTNLFEVELILEKNRNGPNGKVKLNFRS
DTSSFISQYSPSFDDQYS*
50
100
150
200
250
300
350
400
450
469
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3838C2409N657O727S8
Molecular weight (pH 7.5; Da) 53892.58 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23380
Instability index 43.39
Is stable False
Aliphatic index 93.39
GRAVY (25C, pH 7.0) -0.408
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit replicative DNA helicase
[c]: (6) MG_094_MONOMERMG_094_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0201].
References
  1. Mitkova AV, Khopde SM, Biswas SB. Mechanism and stoichiometry of interaction of DnaG primase with DnaB helicase of Escherichia coli in RNA primer synthesis. J Biol Chem 278, 52253-61 (2003). WholeCell: PUB_0201, PubMed: 14557266

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26