MG_091_MONOMER – single-strand binding protein family

Name
WID MG_091_MONOMER View in model
Name single-strand binding protein family View in model
 
Genetics
Gene MG_091 View in model
 
Structure
Sequence
1
51
101
151
MNRVFLFGKLSFTPNRLQTKNGTLGATFSMECLDSSGFNNAKSFIRVTAW
GKVASFIVAQNPGVMLFVEGRLTTYKITNSENKNTYALQVTADKIFHPDE
KTTNEEPIKSTVVDSPFMNPKASVTEAEFEQAFPHQDETDFNNITPIFEN
DVQLEEESDD*
50
100
150
161
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1212C799N207O256S5
Molecular weight (pH 7.5; Da) 17973.68 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
8605
Instability index 31.49
Is stable True
Aliphatic index 64.78
GRAVY (25C, pH 7.0) -0.458
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit single-strand binding protein family, tetramer
[c]: (4) MG_091_MONOMERMG_091_TETRAMER
View in model
 
Comments
Comments Sluijter et al showed that a M. pneumoniae homolog forms homotetramers, binds ssDNA and stimulates RecA strand exchange activity [PUB_0802]. Bujalowski and Lohman also showed single-stranded binding proteins is functional as homotetramers [PUB_0334]. Chrysogelos and Griffith showed that single-stranded binding proteins organize into higher order bead-like octameric structures [PUB_0637].
References
  1. Bujalowski W, Lohman TM. Monomers of the Escherichia coli SSB-1 mutant protein bind single-stranded DNA. J Mol Biol 217, 63-74 (1991). WholeCell: PUB_0334, PubMed: 1988680

  2. Chrysogelos S, Griffith J. Escherichia coli single-strand binding protein organizes single-stranded DNA in nucleosome-like units. Proc Natl Acad Sci U S A 79, 5803-7 (1982). WholeCell: PUB_0637, PubMed: 6764531

  3. Sluijter M, Hoogenboezem T, Hartwig NG, Vink C. The Mycoplasma pneumoniae MPN229 gene encodes a protein that selectively binds single-stranded DNA and stimulates Recombinase A-mediated DNA strand exchange. BMC Microbiol 8, 167 (2008). WholeCell: PUB_0802, PubMed: 18831760

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26