MG_089_MONOMER – translation elongation factor G

Name
WID MG_089_MONOMER View in model
Name translation elongation factor G View in model
Cross references PDB: 2RDO
 
Genetics
Gene MG_089 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
MSRTVDLKNFRNFGIMAHIDAGKTTTSERILFHSGRIHKIGETHDGESVM
DWMEQEKERGITITSAATSVSWKNCSLNLIDTPGHVDFTVEVERSLRVLD
GAIAVLDAQMGVEPQTETVWRQASRYEVPRVIFVNKMDKTGANFERSVLS
IQQRLGVKAVPIQFPIGAENDFNGIIDIITKKAYFFDGNKEENAIEKPIP
EQYVDQVEKLYNNLVEEVASLDDQLMADYLDGKPIEIDAIKNAIRNGVIH
CKFFPVLCGSAFKNKGIKLLLDAVVDFLPSPVDVPPAKAIDANNKEISIK
ASDDANFIGLAFKVATDPFVGRLTFIRVYAGVLKSGSYVKNVRKNKKERV
SRLVKMHAQNRNEIDEIRAGDICAVIGLKDTTTGETLTDDKLDVQLEAMQ
FAEPVISLAVEPKTKADQEKMSIALSKLAEEDPTFKTFSDPETGQTIIAG
MGELHLDILVDRMKREFKVEVNIGAPQVSFRETFKSTSEVEGKYIKQSGG
RGQYGHVKIRFEPNKDKGFEFVDKIVGGRIPREYIKPVQTGLENAMNSGP
LAGYPMIDIKATLFDGSFHEVDSSEMAFKIAASLALKEAGKQCNPVLLEP
IMAIEVTVPEQYFGDTMGDISSRRGIIEGTEQRDNVQLIKAKVPLKEMFG
YATDLRSFSQGRGNYVMQFSHYAETPKSVVNEIIANKK*
50
100
150
200
250
300
350
400
450
500
550
600
650
689
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5416C3405N921O1032S24
Molecular weight (pH 7.5; Da) 76536.33 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
39475
Instability index 32.42
Is stable True
Aliphatic index 87.01
GRAVY (25C, pH 7.0) -0.287
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit translation elongation factor G
[c]: (2) MG_089_MONOMERMG_089_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0344].
References
  1. Harlow LS, Kadziola A, Jensen KF, Larsen S. Crystal structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis and implications for its quaternary structure and tRNA binding. Protein Sci 13, 668-77 (2004). WholeCell: PUB_0344, PubMed: 14767080, URL: http://www.pdb.org/pdb/explore.do?structureId=1KTV

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26