MG_087_MONOMER – ribosomal protein S12

Name
WID MG_087_MONOMER View in model
Name ribosomal protein S12 View in model
Cross references PDB: 1P87, PDB: 2Z4M
 
Genetics
Gene MG_087 View in model
 
Structure
Sequence
1
51
101
MATIAQLIRKPRQKKKVKSKSPALHYNLNLLNKKTTNVYSPLKRGVCTRV
GTMTPRKPNSALRKYAKVRLTNGFEVLAYIPGEGHNLQEHSVTLLRGGRV
KDLPGVRYHIVRGTLDTVGVDKRRQQRSAYGAKKPKPKS*
50
100
140
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H1189C693N219O187S3
Molecular weight (pH 7.5; Da) 15677.36 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
9065
Instability index 37.01
Is stable True
Aliphatic index 80.71
GRAVY (25C, pH 7.0) -0.736
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 30S ribosomal subunit
[c]: MGrrnA16S + MG_070_MONOMER + MG_087_MONOMER + MG_088_MONOMER + MG_090_MONOMER + MG_092_MONOMER + MG_150_MONOMER + MG_155_MONOMER + MG_157_MONOMER + MG_160_MONOMER + MG_164_MONOMER + MG_165_MONOMER + MG_168_MONOMER + MG_175_MONOMER + MG_176_MONOMER + MG_311_MONOMER + MG_417_MONOMER + MG_424_MONOMER + MG_446_MONOMER + MG_481_MONOMER + MG_522_MONOMERRIBOSOME_30S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 30S ribosomal particle. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:26