MG_086_MONOMER – prolipoprotein diacylglyceryl transferase

Name
WID MG_086_MONOMER View in model
Name prolipoprotein diacylglyceryl transferase View in model
 
Genetics
Gene MG_086 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MNRPSWSTAFNIGGGFPIQWYGIIVSIGIIFAILMFVFKLIYCYKLQDNS
FYFFIFIAVLTMVLGARLWSFVIGDSNFANNNFFDFRNGGLAIQGGILLT
SIVGVIYFNFFLNSKTNKTKTIAELLNNKNEIKAVYVERNISVLVMLDLI
APCVLIGQAIGRWGNFFNQEVYGFALAGTMNDPQALANTQWGFLKILMPK
VWDGMWIDGQFRIPLFLIESFFNTIFFVLIYFVMDFIRGVKSGTIGFSYF
LATGIIRLILENFRDQTFYFQTSITTSILFIVVGILGIFYCQFIHVKLRN
YFWTYFFLYAFYKVAAFFTTLFLNNRKQMAQQKFAFYEKSLPNKKRSFFE
MKYYNDVTTPKIYRLTDQEMKLFDKLEAVTTS*
50
100
150
200
250
300
350
383
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3167C2121N493O527S14
Molecular weight (pH 7.5; Da) 44452.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
72685
Instability index 26.23
Is stable True
Aliphatic index 100.29
GRAVY (25C, pH 7.0) 0.438
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme prolipoprotein diacylglyceryl transferase
CYS[c] + PG160[m] ⇒ diacylglycerolCys[c] + H[c] + SNGLYP[c]
View in model
 
Parameters
Parameters Parameter_0104: lipoproteinDiacylglycerylTransferaseSpecificRate = 0.0165 1/s View in model
 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:25