MG_085_MONOMER – HPr(Ser) kinase/phosphatase

Name
WID MG_085_MONOMER View in model
Name HPr(Ser) kinase/phosphatase View in model
 
Genetics
Gene MG_085 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MKHLTVKALVLQFNDCIQLIDGKNNIDNVITIPGLKRSVFELLGLFCKPI
GSVAILGKREFIFLNQKPVEQQKKIIANLLKLKPPAVILTKSFLDCGVLL
AVNQTYQVPILKTNLFSTELSFTVETYINEQFATVQKLHGVLLEIFGVGV
FLEGKSGIGKSESALDLINKNHLLIGDDAIEIYRLGNRLFGRAQALAKGF
MEIRGLGIINIERAYGLQITKEQTEIQLAISLLSLEEKNNASFERLGSDL
KLKNLLGVKISYYQIPISSGRKTSEIIESAVIDFKLKKSGYNSANEFILK
QRAMLEEQTDE*
50
100
150
200
250
300
312
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2578C1579N409O451S6
Molecular weight (pH 7.5; Da) 34700.12 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10805
Instability index 30.54
Is stable True
Aliphatic index 118.75
GRAVY (25C, pH 7.0) 0.0878
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit HPr(Ser) kinase/phosphatase
[c]: (6) MG_085_MONOMERMG_085_HEXAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homohexamer [PUB_0006]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [96].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:25