MG_084_MONOMER – tRNA(Ile)-lysidine synthetase

Name
WID MG_084_MONOMER View in model
Name tRNA(Ile)-lysidine synthetase View in model
 
Genetics
Gene MG_084 View in model
 
Structure
Sequence
1
51
101
151
201
251
MASEKQYIAGVSGGSDSMLMLKLYQKKIACVVHVNYNTRSTSLRDQKLVE
QYCQKLNIPLVVHTVDPDLVWKKNFQNQARKIRFDQFKKTAKLYQTNKLL
LAHHRDDFIEQAKMQLDAKKRAVYYGIKTRCELYGLKIYRPLMKYWKDEI
IALCRQDHIPYEIDETNKLPIYKRNEVRLEIEKWSKIEKEQFYIAICAMN
KTIAQKLFVLMKKAKKWLLQPDVRELKRFSIIDQKQLIYSYLIYHKINVN
GEKIDAILDFIQPSQQKQYRLQNDIFLMVKNQCLALLYKS*
50
100
150
200
250
291
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2544C1578N422O424S14
Molecular weight (pH 7.5; Da) 34660.47 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
49570
Instability index 33.99
Is stable True
Aliphatic index 98.18
GRAVY (25C, pH 7.0) -0.449
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit tRNA(Ile)-lysidine synthetase
[c]: (4) MG_084_MONOMERMG_084_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer [PUB_0049].
References
  1. Kuratani M, Yoshikawa Y, Bessho Y, Higashijima K, Ishii T, Shibata R, Takahashi S, Yutani K, Yokoyama S. Structural basis of the initial binding of tRNA(Ile) lysidine synthetase TilS with ATP and L-lysine. Structure 15, 1642-53 (2007). WholeCell: PUB_0049, PubMed: 18073113

 
Metadata
Created 2012-10-01 15:07:47
Last updated 2012-10-01 15:14:25