MG_078_MONOMER – oligopeptide ABC transporter, permease protein

Name
WID MG_078_MONOMER View in model
Name oligopeptide ABC transporter, permease protein View in model
 
Genetics
Gene MG_078 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MDRNKSFDPNLFKRVDINLLKRNDQLIGKPTTNSIEIIKRLFQNKWAILF
FLLIVVIVLLAIIVPLTSPFSAVTPVSTNALAQNLPPRYLWHKPGDILVH
KITARSIAEISQASGVLVGTLPSANSNPLATNVQYDIAPFQLQELRNYFP
LLGTNGLGIDIWTLLWASVAKSLWIAVVVAIIAMVFGTIYGAVAGSFVGH
MADNIMSRIIEIIDIVPSILWIIVLGATFRFGGVKQFDDSVVIFTLIFVF
WTWPATTTRIYILKNKDTEYIQAAKTLGAHQIRIIFVHMLPVVFGRLAVV
FVSLIPAVIGYEASLVFLGLKPATDIGLGALLNQVTSSDNVALILSSIVS
FAVLTVAARTFANALNDAIDPRVVKR*
50
100
150
200
250
300
350
377
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3074C1932N484O504S5
Molecular weight (pH 7.5; Da) 41306.22 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
54430
Instability index 34.41
Is stable True
Aliphatic index 130.58
GRAVY (25C, pH 7.0) 0.672
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit oligopeptide ABC transporter
MG_077_MONOMER[m] + MG_078_MONOMER[m] + MG_079_MONOMER[c] + MG_080_MONOMER[c] + MG_321_MONOMER[e] ⇒ MG_077_078_079_080_321_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_077_078_079_080_321_PENTAMER). Complex transports oligopeptides of 2-6 amino acids, E. coli oppABCDF favors 3>4>5>2>1 amino acids, favors L>D [PUB_0424], substrate binding protein oppA homolog not present in M. genitalium or M. pneumonia; perhaps ATP-binding or transmem
References
  1. Guyer CA, Morgan DG, Staros JV. Binding specificity of the periplasmic oligopeptide-binding protein from Escherichia coli. J Bacteriol 168, 775-9 (1986). WholeCell: PUB_0424, PubMed: 3536860

 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:25