MG_075_MONOMER – 116 kDa surface antigen

Name
WID MG_075_MONOMER View in model
Name 116 kDa surface antigen View in model
 
Genetics
Gene MG_075 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
MKLSTITTICLSISGAFGTTAIALPTTVALLKNHQQQNTEKQQNPIKDIR
FGLNNVQVPNTIPLHQTVVEVTNNKAIVDYKDAPQKFFLAKSALNNKLQV
EFDKFLLRTGVINALNADLKEWIDQTLFIPNQSFFDLSANKLNLTLSNQS
EVSLDLEFIFTNFSDKNQPLKLPFDGSVVVNANESYTYSVKATLQKLKVL
TYSRADHSVGISYAIPTVSLNGKTQNDFSFNPFKSNINFAFKNVYNALNP
FEAQQYLVGQGKFLNQKVNADDVKNDINNHIETQFNVAKITATLLGKAFK
QFGEHKNGQPLSLLKVLSGLNNEFKQLFNYVRPGLGDFVSDLIQSSSQSS
NKKTVYQLLFENKTTIIHLLQDLNISELNSVLPVVDILFEGINSAESLYQ
RIQSFKDLIVPALKADKQLKSLEAIILAVLDNPNTYVFDLVYQNKSILFN
LLSDFLKNTANTLPFLQEQFDIVNHLFANEAIFDLFSNADFVEKIADLFL
AKQKVQEVNNDGTKSTKIVDSILVATLKGLVGDQLSSITELLNIYIFENE
FLNRNDSNSSVKKQQTDSLKNLFSVIGDILSETNVNKITLHAVKNNELLS
LVETASTLKIKHLNVQYKVLVDKFELKNSFIKELLNFFPDTKDITPTIKK
VLFESENYKTLRKKYENEGFPGYHWAKFIVPGTFNSAENTFYSAIDKTKS
IRDLFADMLFGKSLESVNDSDSFIKINGSFTLKYHGDNLNLLPNYHSLIT
KNVGYQIVNVNFHIDARLLTAELQNTVFSNPKPVIKSPVELSKSLFEVWK
TIFENSVNQILKKEYTFKDNLKFFPFKADGSSRLEFDLSKPDQRVIPFAF
VDGYQFQLKKELIPNKETKKEANSSPVLKLYDAVKRNDRQYRPNHHHDDL
RNYPSLKSQLELILNLGDKLKANNDFIDDTVVNALQYKTSFKSTLKVNSL
GIPINLFFFTLWLKFNLEIPIDGSLTLTSVNVVFPYSLYDTSSNEFTRIV
DRLNFTDTNFYLKDAFPNFWFVGF*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1025
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: lipoprotein, Location: N, Length: 9 (nt) View in model
Empirical formula (pH 7.5) H8304C5331N1354O1561S3
Molecular weight (pH 7.5; Da) 116434.97 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
72325
Instability index 23.58
Is stable True
Aliphatic index 97.92
GRAVY (25C, pH 7.0) -0.212
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:25