MG_074_MONOMER

Name
WID MG_074_MONOMER View in model
 
Genetics
Gene MG_074 View in model
 
Structure
Sequence
1
51
101
MRQFIKLSLLVFVLLFLSELICRFSLRLVNSIKARYKSSVFSYTACLLFL
KSFQNFSNAFQKLANWVFWFENDVNELLSIFYFNFDQKSEKVDYNFFNGY
KVTAQKVVEKEQLLTCKLSDYYRLFRDKTFWFELINN*
50
100
138
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 23 (nt) View in model
Empirical formula (pH 7.5) H1179C788N187O202S4
Molecular weight (pH 7.5; Da) 16632.14 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
27305
Instability index 10.18
Is stable True
Aliphatic index 95.29
GRAVY (25C, pH 7.0) 0.0884
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:25