MG_072_MONOMER – preprotein translocase, SecA subunit

Name
WID MG_072_MONOMER View in model
Name preprotein translocase, SecA subunit View in model
Cross references PDB: 2VDA
 
Genetics
Gene MG_072 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
MAIFNFLKLISPKNRILSKANRIASEVESYKNYYRNLTDQQLFEESNKLV
DLVTKQNYTILDVCVAALALIREVVYRETGEFAYRVQIIGAFIVLSGDFA
EMMTGEGKTLTIVLAAYVSALEKRGVHVVTVNEYLAQRDANNAMKILKRV
GMSVGCNFANLSPQLKQAAFNCDVTYTTNSELGFDYLRDNMVHSYQDKKI
RELHFAIVDEGDSVLIDEARTPLIISGPSKNEFGLYVAVDRFVKSLTEQE
FKIDPESRAASLTELGIKKAEQTFKKENLFALENSDLFHKIMNGLTAVKV
FEQGKEYIVRDGKVLIVDHFTGRILEGRSYSNGLQQAVQAKEYVEIEPEN
VIVATITYQSFFRLYNRLAAVSGTALTESEEFLKIYNMVVVPVPTNRPNI
RKDRSDSVFGTPQIKWMAVVKEIKKIHETSRPILIGTANIDDSELLHNLL
LEANIPHEVLNAKNHSREAEIVTKAGQKNAVTISTNMAGRGTDIRLGEGV
AEMGGLYVLGTERNESRRIDNQLRGRAARQGDKGETKFFISLGDSLFKRF
AHDKIERAISKLGNETFDSAFFSKMLSRTQKRVEAINFDTRKNLIDYDHV
LASQRELIYKQRDKFLLANDLSEMIDKMLEKFVQQFCDQYRNQKNQNLIN
HIALAEALNLEMNMQNTINPKVFENMTFDVAVDKTRNLVAKKISDKVNVL
TKPIALNRFRDIIITSMDKHWTEHLDSVFKLREGVVLRSMEHTSPLNVYI
KETDILFKTMLQKIAQDVIVQIANLTTPDEFDHSLMQANALKKLAAIKAD
EKSNQE*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
807
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H6539C4076N1124O1219S25
Molecular weight (pH 7.5; Da) 91594.70 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
45770
Instability index 27.47
Is stable True
Aliphatic index 95.33
GRAVY (25C, pH 7.0) -0.279
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit preprotein translocase, SecA subunit
[c]: (2) MG_072_MONOMERMG_072_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0004]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96].
References
  1. van Wely KH, Swaving J, Freudl R, Driessen AJ. Translocation of proteins across the cell envelope of Gram-positive bacteria. FEMS Microbiol Rev 25, 437-54 (2001). WholeCell: PUB_0004, PubMed: 11524133

 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:25