MG_071_MONOMER – ATPase, P-type (transporting), HAD superfamily, subfamily IC

Name
WID MG_071_MONOMER View in model
Name ATPase, P-type (transporting), HAD superfamily, subfamily IC View in model
 
Genetics
Gene MG_071 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
VNSWTGLSEQAAIKSRQEHGANFLPEKKATPFWLLFLQQFKSLVVILLLL
ASLLSFVVAIVSGLRSNWNFNHDLIIEWVQPFIILLTVFANSLIGSIQEF
KAQKSASALKSLTKSFTRVFRNGELISINVSEVVVGDIIFVDAGDIIPAD
GKLLQVNNLRCLESFLTGESTPVDKTIDSNEKATILEQTNLVFSGAQVVY
GSGVFQVEAVGIKTQVGKIAKTVDDSVTKLSPLQQKLEKIGKWFSWFGLG
LFAVVFLVQTALLGFDNFTNNWSIALIGAIALVVAIIPEGLVTFINVIFA
LSVQKLTKQKAIIKYLSVIETLGSVQIICTDKTGTLTQNQMKVVDHFCFN
STTQTDLARALCLCNNASISKDANKTGDPTEIALLEWKDRSQLDLKTYYR
VYEKAFDSIRKLMTVVVQKDNRFIVIVKGAPDVLLPLCNNVQNEVKNIEN
LLDQSAGQGLRTLAVALKVLYKFDQNDQKQIDELENNLEFLGFVSLQDPP
RKESKEAILACKKANITPIMITGDHLKTATVIAKELGILTLDNQAVLGSE
LDEKKILDYRVFARVTPQQKLAIVSAWKEAGFTVSVTGDGVNDAPALIKS
DVGCCMGITGVDIAKDASDLIISDDNFATIVNGIEEGRKTFLTCKRVLLN
LFLTSIAGTVVVLLGLFILGQVFKTNLLQQGHDFQVFSPTQLLIINLFVH
GFPAVALAVQPVKEKLMVGSFSTKNLFYNRQGFDLIWQSLFLSFLTLLFY
SLGIIYAINNRDLQTSGDLINRAGSTCGFFILGASAALNSLNLMVDKPLL
MTNPWFFKLVWIGSLASILVFLLIIFINPLGLVFNVLQDLTNHPVLISYS
FGGVILYMGMNEVVKLIRLGYGNI*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
875
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7050C4421N1111O1243S20
Molecular weight (pH 7.5; Da) 96295.00 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
86745
Instability index 23.77
Is stable True
Aliphatic index 119.28
GRAVY (25C, pH 7.0) 0.375
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0213, PUB_0214].
References
  1. Carafoli E, Brini M. Calcium pumps: structural basis for and mechanism of calcium transmembrane transport. Curr Opin Chem Biol 4, 152-61 (2000). WholeCell: PUB_0214, PubMed: 10742184

  2. Norris V, Grant S, Freestone P, Canvin J, Sheikh FN, Toth I, Trinei M, Modha K, Norman RI. Calcium signalling in bacteria. J Bacteriol 178, 3677-82 (1996). WholeCell: PUB_0213, PubMed: 8682765

 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:25