MG_069_MONOMER – PTS system, glucose-specific IIABC component

Name
WID MG_069_MONOMER View in model
Name PTS system, glucose-specific IIABC component View in model
Cross references PDB: 1O2F
 
Genetics
Gene MG_069 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
MQISLVKIRNKFKQRNRGSFRQWVGKLSNGLMIPIAVLPLAGIFLGIGDA
ISSNSSGIVGVKFFGEFIKQGGNVVFANLPILFAVAIAITFSQDAGVAGF
SAFVFWATMNAFMSSLIIPVDANNTASGYNILYWKAVPQSAIASTLGLNS
LSTSVFGGIIVGALTAYLYNKFYAIRLPDVIGFFSGTRFVPIICMTIAIP
VALLLLMVWPGVSILLNLIGTGLGILGGRGYGANSLIFGYIERALIPFGV
HHAFYAPLWYTSAGGSLQEIANQQVWIRAPGSDYVTRVIGWEDFNTPGKW
VIPAALANGTSGMMNGATTTGQDSTSALSKYMSKESTNFLSWKELVDGLT
RKGNFDELAKNGLLDGSNKIWIGLNQSGILGKKVLLSDGKDYTITFKTFA
NTTPTFWSHGAHALLPISGTPSAITNGVTVNGTANSKTYNVSQFTVAVPS
LNPAQYSQGKFPFMLIGIPAAGLAMILAAPKGRRKEASSIIGSAAFTSFL
TGITEPFEFTFLFLAPWLFYGIHAVLAAVSFWLMNLLSANVGQTFSGSFI
DFILYGALPDGRGWLANSYLVPIIGIFLALIYFPTFYFLTIRFNLATPGR
GGKLITKKEYLAAKAAQKTDQTTNTNFNQTQIEAGMLLRAYGGSENIAEL
GACITKLRVTVKNPELVNETIIKDLGAAGVMRTTPTFFVAVFGTRAAVYK
SAMQDIIQGKVNWTELQKVLDKNDSTVEKPEIKPTPVLKVQDEIVILSPV
NGTLKPLTQVPDDTFKNRLVGDGIAILPSDGHFKAPGDVGVKTELAFPTG
HAFIFDVDGVKVMLHIGIDTVKINADKKPGEQLEVFDVKTKQGEYTKLKS
ESVVEVDLKKLKRKYDPITPFIVMQESLDNFKLVPIRQRGEIKVGQPLFK
LIYKDKKS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
909
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7123C4541N1145O1254S19
Molecular weight (pH 7.5; Da) 98430.01 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
120000
Instability index 24.78
Is stable True
Aliphatic index 100.11
GRAVY (25C, pH 7.0) 0.231
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit PTS system, glucose-specific
MG_041_MONOMER[c] + (2) MG_069_MONOMER[m] + (2) MG_429_MONOMER[c] ⇒ MG_041_069_429_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_041_069_429_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24