MG_068_MONOMER – lipoprotein, putative

Name
WID MG_068_MONOMER View in model
Name lipoprotein, putative View in model
 
Genetics
Gene MG_068 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
VLRRYLTLSFSSLLLLALLFLTGCSFVRPQFRRGFRTQFKINSIPTVSDP
YHINYDLTFSLNFASNKRNTYGTGWLIDWKGDENNPEKNDPFKVYLATNL
HVIDALRNNNDYEPYNKDSNNQAFNSEEITRFFSIGKYTYPSIFSELNFI
INAREAFVSIQTSTIPKTAYAAVNFVETQGEDESYTDSLSTDNKRDIYAD
FAVIEIPLFLTNHRDYQVFNEFIKPAIETYKQLGNSSFEKKQLDQHKNDN
FYMLGYPLVESSIDALILNQRRQYNNSYTEKYTPQTLTKDQRTIDLSREV
PTLIQNKTENSTGSQLLVNQSLSSTSEGIIEFIKLPEFKLNYHNKSYRQY
GRGFALQNTNFRPGSSGTLMLNNQKQIAGIYFGVLDFGEDVSLMSNIGVG
QILRVPQKNNTRNRSIATNKSNYDLIFGDSNTTNFYAKFARQNNTHLYQM
ISNSKDTKLKYVNTVEKTVKASIK*
50
100
150
200
250
300
350
400
450
475
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: lipoprotein, Location: N, Length: 23 (nt) View in model
Empirical formula (pH 7.5) H3778C2452N660O747S5
Molecular weight (pH 7.5; Da) 54614.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
51355
Instability index 39.09
Is stable True
Aliphatic index 78.00
GRAVY (25C, pH 7.0) -0.558
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Comments
Comments Signal Peptipde Signal peptide of length 23 (SPdb322131, MLRRYLTLSFSSLLLLALLFLTG) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24