MG_066_MONOMER – transketolase

Name
WID MG_066_MONOMER View in model
Name transketolase View in model
Cross references PDB: 1QGD, PDB: 2R8P
 
Genetics
Gene MG_066 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
MKYLYATQHLTLNAIKHAKGGHVGMAIGASPILFSLFTKHFHFDPDQPKW
INRDRFVLSAGHGSMALYSIFHFAGLISKQEILQHKHGQINTSSHPEYAP
NNFIDASTGPLGQGFGMAVGMVLAQKLLANEFKELSDKLFDHYTYVVVGD
GDLQEGVSYEVSQIAGLYKLNKLIVLHDSNRVQMDSEVKKVANENLKVRF
ENVGWNYIHTDDQLENIDQAIIKAKQSDKPTFIEVRTTIAKNTHLEDQYG
GHWFIPNEVDFQLFEKRTNTNFNFFNYPDSIYHWFKQTVIERQKQIKEDY
NNLLISLKDKPLFKKFTNWIDSDFQALYLNQLDEKKVAKKDSATRNYLKD
FLNQINNPNSNLYCLNADVSRSCFIKIGDDNLHENPCSRNIQIGIREFAM
ATIMNGMALHGGIKVMGGTFLAFADYSKPAIRLGALMNLPVFYVYTHDSY
QVGGDGPTHQPYDQLPMLRAIENVCVFRPCDEKETCAGFNYGLLSQDQTT
VLVLTRQPLKSIDNTDSLKTLKGGYILLDRKQPDLIIAASGSEVQLAIEF
EKVLTKQNVKVRILSVPNITLLLKQDEKYLKSLFDANSSLITIEASSSYE
WFCFKKYVKNHAHLGAFSFGESDDGDKVYQQKGFNLERLMKIFTSLRN*
50
100
150
200
250
300
350
400
450
500
550
600
649
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H5148C3337N885O968S20
Molecular weight (pH 7.5; Da) 73793.02 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
74105
Instability index 28.63
Is stable True
Aliphatic index 87.00
GRAVY (25C, pH 7.0) -0.332
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit transketolase
[c]: (2) MG_066_MONOMERMG_066_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 MG, MN, or CA per monomer as prosthetic group [96,387].
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24