MG_065_MONOMER – ABC transporter, ATP-binding protein

Name
WID MG_065_MONOMER View in model
Name ABC transporter, ATP-binding protein View in model
 
Genetics
Gene MG_065 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MDFFSLNKIIKPNQKFTSNEAEFLQIATDYLEESQNYLQKGLKQLKKEYK
RSIIYNPNLEYKRFVKWKENFTETFESYYDRFFITKYNHYSLSLLFSFIN
EQIETVIASYNSFLNEHNKLAFNKVSFSFEKKLFEATQQFNNLEKNTAIS
DDLPLQFKVRTTQLKAQRERELKNLLNKIKLKNLSEKKQEILLNNWFNSN
ERLFLKNEVKKVNWLNSPRQKQQAAQIDDQNIIELKNVYKYITNGITTNA
VLKGVDLAIKSHDFIVILGPSGSGKTTLLNIISGMDRASSGSVIVNGYNM
ICLNDRKLTKFRQKYVGYIFQQYGLLPNLTVRENIEIGANLQPDPSKRIS
IDALLEAVGMDSLQKKLPNELSGGQQQRVSIARAFAKNPLLIFGDEPTGA
LDLEMTQIVLKQFLAIKKRYQTTMIIVTHNNLIANLADLVIYVADGKIKS
LHRNLNPKQVEEIHWI*
50
100
150
200
250
300
350
400
450
467
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3903C2452N653O705S7
Molecular weight (pH 7.5; Da) 54034.48 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48945
Instability index 31.01
Is stable True
Aliphatic index 97.30
GRAVY (25C, pH 7.0) -0.405
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit ABC transporter
(2) MG_064_MONOMER[m] + (2) MG_065_MONOMER[c] ⇒ MG_064_065_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_064_065_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24