MG_064_MONOMER – ABC transporter, permease protein, putative

Name
WID MG_064_MONOMER View in model
Name ABC transporter, permease protein, putative View in model
 
Genetics
Gene MG_064 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
1251
1301
VLNLIKNVIRSLKSAKIALIALTFLIFVAVGGFVLLNNTVNNFNAAFNYV
THTGKLSNAIINERYDFGKLEFQEQTNNSQNSSDSFTLTLTNDSRTSFIN
NALRTNPSLYEGLVTQTFSYQNKTEMTEKTNIVNQSKIIAANNLNNALSK
DKQLLVSGQLEKLNAVFREYKAINITDKSVFKKLIVSEPNDLVNSLVIFD
GQNLSSSKQSDFNNFLNQFNEIKSKGKDNLSTTLKTGQYQAFLQTLFDYA
QASETTLKDQLQKLISNPDSSETNQVKNLFDTPSTLTNIGGQLTLQWTEN
SLTKQIVIFDPSSYETIVAPGNWTYQQQLGKEVYPDINNWESIKKLPLEQ
FESEFLKIDQKYKISIDNIDYLVIGVGISPDFVYPVFSASLIVPNIENEQ
LYYVNQTGYERTFSSFLTNPVETAIVARLINLESDLNTINQWAVENMSWP
TNIKAAYSSSDTTNILNLLAARTVFIPNLINTINLVALFLTIAILTVAII
VSILILISYLKKNTEQIGILKANGLSGKKINLSLLIFGLIPAIVGAISGY
SFGIGFQDVAIHLFSNYWFIPTATSSFSVVGLLFFSLFVILIMSSISLLV
GSIILKKDVVKILKHDSEFKVSRLGLSSKKLFARFGIMTRFRVALAFNAP
WKLVFLTLMSSFTMMILNLSFATKDSFENAQSKTNLTNQNHQYEFELASA
TTQSGLLKWQLFAELGTTDKRSESSVKLANKRMDISNVDASKDWKNQQVI
NFLSDASGFSNDLNYLENIVQSKIGLDYSLGFNNIVSNPWRLSETLMPTN
QASASNTAFQNFLKAIITINPSQGSQFIKQTQDPLTKRFIYAIDSDKALK
NNNEQNGSQNHLTLNDDFAKFLYSQFELIKKSGNASNEDLNAIDFENPQT
IRDFYNKYNALPPLDYKLSFNVIGLPKETIAGQIDTPKYGFLTLHGEYQN
TPIKIKGIKDWKDKVDNLGPVLSDQNNHIINQELFKNYSFDPLIVNNSAA
KKYQLAIGSEINIAVNNSFKRIDNKIINQDPLVNATFRVVGINNSAHDPE
FFTSYSTAFKVLEYPNEWFVKKLPFNSFYANSLLSFVQSTSLFSESGIFP
ATSSFSTNNTVLVELIKKTINYKNGQMNQTSSNDSSKKENYQKLQKALGI
STDLEISKVNEYVAILARVYNGLPYNSTISFISNVAANNALFGNIANTTK
QIQAVVIAVIIPIIMLIILLVSTTLIQELKKIAIRLKALGYSNLKILASF
LSIYIPLFAFGLLISIPFSIYLIALHNEVIFASSSIFLDAFLSFESAIGS
MLVLLAVLSITFVLNWLELNKIKIDKEIKNS*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1250
1300
1332
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H10687C6803N1716O2006S12
Molecular weight (pH 7.5; Da) 148995.29 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
135570
Instability index 26.29
Is stable True
Aliphatic index 104.98
GRAVY (25C, pH 7.0) 0.00878
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit ABC transporter
(2) MG_064_MONOMER[m] + (2) MG_065_MONOMER[c] ⇒ MG_064_065_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_064_065_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24