MG_063_MONOMER – 1-phosphofructokinase, putative

Name
WID MG_063_MONOMER View in model
Name 1-phosphofructokinase, putative View in model
 
Genetics
Gene MG_063 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MTWLQNITKESKIWIVNYACAIDYYVDLNKQKNSVLIPGGKGINVAIVMK
SLGFDPTVITFLGQPTKNLFLELVKPYDLNIVSFISETKTRINLKLLKDE
KTTEINDLSPLITDANLTELLTFLKANVKNNDLVIINGRFKFEALEKVLN
LVFTLTENVVIDVDESKMLTLLNQSKPLVMKPNIDEFQTMINTFFHDQQS
LIAAIKKFHYCKLLLLSDGDKGAYLFDQNKLLFVSSITPKQVVSTTGAGD
TLLAVFLANLILKVDLKTALIKATNYASATISKLGVVDSKDKISVITPKS
YYL*
50
100
150
200
250
300
304
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2520C1559N378O447S7
Molecular weight (pH 7.5; Da) 33935.31 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24660
Instability index 26.46
Is stable True
Aliphatic index 117.96
GRAVY (25C, pH 7.0) 0.172
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 1-phosphofructokinase, putative
[c]: (2) MG_063_MONOMERMG_063_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [386].
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24