MG_062_MONOMER – PTS system, fructose-specific IIABC component

Name
WID MG_062_MONOMER View in model
Name PTS system, fructose-specific IIABC component View in model
 
Genetics
Gene MG_062 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
MFKNLLRPSLFFNWSQKTFKNKFSFLKQAANALQKQAVINDNNVAFEALK
KREEEITTGIITSLALPHLQSQSVIEPFVAVFKVKNLDWQSLDQKPVKLI
FLIGVLVDKTNLHLDFISNFSKLMLNETFASKVLNVTSYNGLIKLIDLFN
QQKVQDQPAVETKKEYDFVAVTACPTGIAHTFMAKEALEAFAKKHNLYVK
VETQGTDGIQNQLTSDDINNAKGVILACDRLIDFSRFYANKNVIEVSTTK
AIKKPDEVYELIKNQKGKQLANSAKPTNQTQLAESEGEFNFNNFHKRIYR
AILSGVSYMLPFVVFGGILIALSFLIDINNANNAGGNFGTINPVANWLNK
LGGISFSLIVPILSAYIAYALVSRQGLLPGFVVGLISSGQFLLNIVLTNG
TIEWLAPSQVSSGFFGAIFGGLLSACLIIVQQNYIYKKLPQSLQGIKNIL
FIPLFGTLFTAGLFWVINIPLIYLNYGLSLFLNIMNSPILAPLLGFVIGL
MMCFDLGGPINKAAYVFGVVSLQNQNAGTISMAAAMLSGMVPPLSIALAA
SIRKSCFDKQELPAAYACYLMGLSFISEGAIPFVVKKPKVMLTANLIAGA
ICGALTGAFALSIRAPHGGVFVFALLKTTLQGIEGATLQTGVGIGLALVC
LIISMIVGSSIIIGYDLIAKHNQRKQNLNS*
50
100
150
200
250
300
350
400
450
500
550
600
650
681
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H5428C3417N857O933S21
Molecular weight (pH 7.5; Da) 74115.99 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
53830
Instability index 36.59
Is stable True
Aliphatic index 113.88
GRAVY (25C, pH 7.0) 0.400
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit PTS system, fructose-specific
MG_041_MONOMER[c] + (2) MG_062_MONOMER[m] + (2) MG_429_MONOMER[c] ⇒ MG_041_062_429_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_041_062_429_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24