MG_061_MONOMER – Mycoplasma MFS transporter

Name
WID MG_061_MONOMER View in model
Name Mycoplasma MFS transporter View in model
 
Genetics
Gene MG_061 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
VENKSQKKVSDLKLITLWIIVIFGYLLFVVEWFVIDRISGKPTGILTQST
TTLPQYSGWLSSFFTENAGQIATSSTNWTITLLRAVGSILCGVVVLKFGY
RYAVLIMMGIMCVCFPFLIIGDPLNGHNQLTLLRPLSDSVKTQLSSLSSN
LQVGQLLGPVMINGKTMLADGTSVELIKGLDGNSIGTAASITGYALFIIF
RSTIAIGGTTLVVYTQPAIANLSSNRKKSILSNANLWGFNIGIAVVFTPF
LFEQVQQVASQYWVYIMTVMILVVFANLCLFLWFESKIDHIFPQKQTKEN
MSLTTQPKSIDILKNKTTWKLIGVYGIVLILIVNPLTPAWFSILQTVSPS
GSNGLISTGVYTTGLATLAIFWVIGYALGFVVFSPFNKTIYDKKRWMHFL
LTANIVVLLIIIMFAATLGIGSAAGFALISIFSFIGGAFAWSLSSSNLIL
PYEFKDYKKNELPILFGFCWGFGYIAYTLFDITQSVFLQAPVLIQGKGTS
ILPGVIVSIVFFLGLIALANLIVKFFPACWIKDGDQLVQEMTRKWKLNEW
QFVIANKQKNRYSELLK*
50
100
150
200
250
300
350
400
450
500
550
568
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4618C2956N698O771S17
Molecular weight (pH 7.5; Da) 62815.43 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
114080
Instability index 32.74
Is stable True
Aliphatic index 118.91
GRAVY (25C, pH 7.0) 0.616
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0095, PUB_0316].
References
  1. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

  2. Law CJ, Maloney PC, Wang DN. Ins and outs of major facilitator superfamily antiporters. Annu Rev Microbiol 62, 289-305 (2008). WholeCell: PUB_0316, PubMed: 18537473

 
Metadata
Created 2012-10-01 15:07:46
Last updated 2012-10-01 15:14:24