MG_059_MONOMER – SsrA-binding protein

Name
WID MG_059_MONOMER View in model
Name SsrA-binding protein View in model
 
Genetics
Gene MG_059 View in model
 
Structure
Sequence
1
51
101
MLILVNNPKAKYDYHLMESYCAGIVLKGSEVKALSLGQGSLKEAYVFVKN
NELFLEQFTIPPYSFAGPLNHASDRIKKLLLNKHEIKQIINKKQQQSLSV
IPSKVFFRNGKIKVEIWLAKPKKKFDKRETIKKKTIRRELEAEYR*
50
100
146
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1268C776N207O206S3
Molecular weight (pH 7.5; Da) 16889.78 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14565
Instability index 30.27
Is stable True
Aliphatic index 96.16
GRAVY (25C, pH 7.0) -0.449
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Parameters
Parameters Parameter_0138: tmRNABindingProbability = 1e-05 dimensionless View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0014, PUB_0020, PUB_0382].
References
  1. Eds Lund P. Molecular Chaperones in the Cell. Oxford University Press, New York (2001). WholeCell: PUB_0014, ISBN: 9780199638673

  2. Gutmann S, Haebel PW, Metzinger L, Sutter M, Felden B, Ban N. Crystal structure of the transfer-RNA domain of transfer-messenger RNA in complex with SmpB. Nature 424, 699-703 (2003). WholeCell: PUB_0382, PubMed: 12904796

  3. Karzai AW, Roche ED, Sauer RT. The SsrA-SmpB system for protein tagging, directed degradation and ribosome rescue. Nat Struct Biol 7, 449-55 (2000). WholeCell: PUB_0020, PubMed: 10881189

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:24