MG_058_MONOMER – ribose-phosphate pyrophosphokinase

Name
WID MG_058_MONOMER View in model
Name ribose-phosphate pyrophosphokinase View in model
 
Genetics
Gene MG_058 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
LKLSIDNKKHVIFSLSKSKTLVENICKKLNISEGKMVCEHFADGETYIRF
DESVRNKDIYIFQSTCPNVNDSLMELLIAIDALKRGSAKSITAILPYYGY
ARQDRKTKGREPITSKLIADMLTKAGANRVVLTDIHSDQTQGFFDIPVDS
LRTYHIFLFRVIELLGKKDLVVVSPDYGGVKRARLIANTLELPLAIIDKR
RPSHNVAESINVLGEVKNKNCLIVDDMIDTGGTVIAAAKLLQKEQAKKVC
VMATHGLFNNDAEQKFMEAFDQKLIDFLFVSNSIPQYKFKAVKQFEVVDL
ASLYEEVVLCYANSLSVSAIYERHIEWIKKHV*
50
100
150
200
250
300
333
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2720C1689N449O488S12
Molecular weight (pH 7.5; Da) 37509.06 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22640
Instability index 36.23
Is stable True
Aliphatic index 104.20
GRAVY (25C, pH 7.0) -0.0715
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit ribose-phosphate pyrophosphokinase
[c]: (6) MG_058_MONOMERMG_058_HEXAMER
View in model
 
Comments
Comments First observed residue by mass-spec 5 [PUB_0280]. Functional Macromolecule Functional as homohexamer. Coenzymes Interacts with 1 MG per monomer as prosthetic group [96].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:24