MG_056_MONOMER – tetrapyrrole (corrin/porphyrin) methylase protein

Name
WID MG_056_MONOMER View in model
Name tetrapyrrole (corrin/porphyrin) methylase protein View in model
 
Genetics
Gene MG_056 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKTLKVVATPIGNIQEISERAKKALQDCEVLFCEDSRVTRKMLDLLNIDC
KQKKFVINNSFKEKQNLTFAEEFITNFKCCLVSDAGYPSLSDPGNEMINW
IISKNKEIRIEVINGPSALMCGLITSGFKTTPLLFLGFLSHKQNQLKNYL
STYQNQKSTIVFFEAVHRLENTLETVKNVFKNNDVFIGRELTKLHESHYW
FNTSENTLPDITLKGEFVIVIDNQNINHQTLSSNQYLVYEIKKLMDIGVK
LKDACNYLAKKMHLKSSMLYTLFHESI*
50
100
150
200
250
278
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2280C1435N374O418S14
Molecular weight (pH 7.5; Da) 31908.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23795
Instability index 30.19
Is stable True
Aliphatic index 94.28
GRAVY (25C, pH 7.0) -0.230
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:24