MG_055_MONOMER – preprotein translocase, SecE subunit

Name
WID MG_055_MONOMER View in model
Name preprotein translocase, SecE subunit View in model
 
Genetics
Gene MG_055 View in model
 
Structure
Sequence
1
51
101
MEKKLPFSFKKKEKLTAYDDASIHELHKQLKLRTEAKKSKDKERTKEKEK
HESLAKEKKPKLPFKKRIVNLWFGVDKEINKIVWVKGRQLIIIFLLILLV
SGLMVGIFFGINQLLITLGIFKN*
50
100
124
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1126C677N175O169S2
Molecular weight (pH 7.5; Da) 14485.34 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12490
Instability index 21.29
Is stable True
Aliphatic index 108.47
GRAVY (25C, pH 7.0) -0.310
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit preprotein translocase
[m]: (4) MG_055_MONOMER + (4) MG_170_MONOMER + (4) MG_277_MONOMER + (4) MG_464_MONOMER + (4) MG_476_MONOMERMG_055_170_277_464_476_20MER
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 12-mer (see MG_055_170_476_12MER) [PUB_0203].
References
  1. Manting EH, van Der Does C, Remigy H, Engel A, Driessen AJ. SecYEG assembles into a tetramer to form the active protein translocation channel. EMBO J 19, 852-61 (2000). WholeCell: PUB_0203, PubMed: 10698927

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23