MG_054_MONOMER – transcription antitermination protein NusG, putative

Name
WID MG_054_MONOMER View in model
Name transcription antitermination protein NusG, putative View in model
 
Genetics
Gene MG_054 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MQASELTPKWYVAPVSIKDEAVVKNLKAKIQALGFNHEIVDVKVLKEREV
HEEVYSLKSGKLPRSLKNTTFNKWFVLDDYRYLRVKISEKNLLGRYIYIK
MIYSEDAWRIVRNFPGITGIVGSSGRGALPIPLDEKDANNLEQMLKGISI
NPSKRIMLTNTAIIEMDSDKFDEKFQYILKQKQAIQKPKEDEDSEIVDAE
KLKEAFKKLQNSQEQDEWKEKATIIQSEQTKLDPSVLVPFLGKYEILDTD
NKVEQLFEFSVGNLVEVHLTDTIHVQGQIKALYQGTVNKAVVEIELTSKT
QLINLPLENLSFVEFE*
50
100
150
200
250
300
317
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2620C1644N423O491S5
Molecular weight (pH 7.5; Da) 36327.15 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
36900
Instability index 29.05
Is stable True
Aliphatic index 98.96
GRAVY (25C, pH 7.0) -0.402
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0383]. 1 monomer binds per rho hexamer [PUB_0383].
References
  1. Pasman Z, von Hippel PH. Regulation of rho-dependent transcription termination by NusG is specific to the Escherichia coli elongation complex. Biochemistry 39, 5573-85 (2000). WholeCell: PUB_0383, PubMed: 10820031

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23