MG_053_MONOMER – phosphoglucomutase/phosphomannomutase, putative

Name
WID MG_053_MONOMER View in model
Name phosphoglucomutase/phosphomannomutase, putative View in model
 
Genetics
Gene MG_053 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MDKLRLEVERWLNHPNVNWELKQQIKELNESEIQELFSLEKPLFGTAGVR
NKMAPGYHGMNVFSYAYLTQGYVKYIESINEPKRQLRFLVARDTRKNGGL
FLETVCDVITSMGHLAYVFDDNQPVSTPLVSHVIFKYGFSGGINITASHN
PKDDNGFKVYDHTGAQLLDTQTNQLLSDLPCVTSMLDLELQPNPKFVHTL
DNEKVYKNYFRELKKVLVINNNNFKDIKVVFSGLNGTSVCLMQRFLKYLG
YSNIISVEEQNWFDENFENAPNLNPEYKDTWILAQKYAKKNNAKLIIMAD
PDADRFAIAELNNNQWHYFSGNETGAITAYYKLNHKVFKSPYIVSTFVST
YLVNKIAKRYGAFVHRTNVGFKYIGQAINELSQTNELVVGFEEAIGLITS
DKLNREKDAYQAAALLLEIARHCKEQNITLLDFYKRILSEFGEYFNLTIS
HPFKATATDWKEEIKALFNQLINANLTEVAGFKVVKVHLDKQTNILEFGF
ENGWVKFRFSGTEPKLKFYFDLTNGTREALEKQAKKIYKFFVNLLKLNKA
*
50
100
150
200
250
300
350
400
450
500
550
551
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4457C2899N753O825S11
Molecular weight (pH 7.5; Da) 63410.49 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
77740
Instability index 24.66
Is stable True
Aliphatic index 88.11
GRAVY (25C, pH 7.0) -0.344
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit phosphoglucomutase/phosphomannomutase, putative
[c]: (3) MG_053_MONOMERMG_053_TRIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotrimer. Coenzymes Interacts with 1 MG per monomer as prosthetic group [96,386].
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23