MG_052_MONOMER – cytidine deaminase

Name
WID MG_052_MONOMER View in model
Name cytidine deaminase View in model
Cross references PDB: 1CTU
 
Genetics
Gene MG_052 View in model
 
Structure
Sequence
1
51
101
MKVNLEWIIKQLQMIVKRAYTPFSNFKVACMIIANNQTFFGVNIENSSFP
VTLCAERSAIASMVTSGHRKIDYVFVYFNTKNKSNSPCGMCRQNLLEFSH
QKTKLFCIDNDSSYKQFSIDELLMNGFKKS*
50
100
131
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1052C671N177O190S11
Molecular weight (pH 7.5; Da) 14991.28 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12085
Instability index 36.00
Is stable True
Aliphatic index 75.88
GRAVY (25C, pH 7.0) -0.140
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit cytidine deaminase
[c]: (2) MG_052_MONOMERMG_052_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96,386,387].
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23