MG_051_MONOMER – pyrimidine-nucleoside phosphorylase

Name
WID MG_051_MONOMER View in model
Name pyrimidine-nucleoside phosphorylase View in model
Cross references PDB: 2TPT
 
Genetics
Gene MG_051 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MNIINLINKKQRGKALNLAEINWFVNAVLNKTIADYQITAFLMAIWFKGM
NPNELFLLTKAMVDTGEIIKFNHHGKISVDKHSTGGIGDKVSLALVPILT
SLGFSVAKLSGRGLGYTGGTIDKLEAVGVKTELTDQQAQACLDKNDCFII
GQSKDIAPVDKVLYGLRDITGTVDSLPLIASSIMSKKLAVMNEYIFIDLK
YGKGAFCKTKKIANELAKLMQSIAKSFKRKLSVKLSDMNQVLGKAVGNVI
EVNEAVNFLKQDLDQVGQDFIDLMQTIVINILLETKQAKTKQKAIELYQD
VLTSKKAWNRFLSFIESQGGNVELFTQKEGFFKPKYKASIKAEKSGILHF
TDPIDLAKIGINLGAGRMKKTDQIDPMAGLFLMKKDNESVAVGDTVLNLY
SSSPISNEYISAAQKTIIINK*
50
100
150
200
250
300
350
400
422
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3414C2093N543O607S15
Molecular weight (pH 7.5; Da) 46377.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30285
Instability index 20.77
Is stable True
Aliphatic index 104.00
GRAVY (25C, pH 7.0) -0.0135
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit pyrimidine-nucleoside phosphorylase
[c]: (2) MG_051_MONOMERMG_051_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23