MG_048_MONOMER – signal recognition particle protein

Name
WID MG_048_MONOMER View in model
Name signal recognition particle protein View in model
Cross references PDB: 2PXU
 
Genetics
Gene MG_048 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MFKAMLSSIVMRTMQKKINAQTITEKDVELVLKEIRIALLDADVNLLVVK
NFIKAIRDKTVGQTIEPGQDLQKSLLKTIKTELINILSQPNQELNEKRPL
KIMMVGLQGSGKTTTCGKLAYWLEKKYKQKTMLVGLDIYRPAAIEQLETL
SQQTNSVFFAQGTQPVAKTTKAALSAFKTAKCQTIICDTAGRLQTNETLM
DELVSVKNELNPDEIIMVVDGLSGQEIINVAQTFHKRLKLTGFIISKLDS
DARAGAALSLASLLQVPIKLIGVSEKLDGLEQFHPERIANRILGLGDVMS
LVEKAEQVFDKKDLTKTISKMFLGKMDLEDLLIYMQQMHKMGSVSSLIKM
LPANFSVSEENAELIENKIELWKVLINSMTREERRHPKLINRDPNRKQRI
IKGSGRKMDELNKLMKEWNKMQLKATEMGKLLKTGSNPFGGFGQFF*
50
100
150
200
250
300
350
400
447
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3721C2231N604O653S24
Molecular weight (pH 7.5; Da) 50223.48 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22835
Instability index 37.98
Is stable True
Aliphatic index 100.78
GRAVY (25C, pH 7.0) -0.209
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit signal recognition particle
[c]: MG_0001 + MG_048_MONOMERMG_0001_048
View in model
 
Comments
Comments Functional Macromolecule Functional as heterodimer (see MG_0001_048) [PUB_0003].
References
  1. Eds Dalbey RE, von Heijne G. Protein Targeting, Transport, and Translocation. Academic Press, San Diego (2002). WholeCell: PUB_0003, ISBN: 9780122007316

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23