MG_047_MONOMER – S-adenosylmethionine synthetase

Name
WID MG_047_MONOMER View in model
Name S-adenosylmethionine synthetase View in model
Cross references PDB: 1RG9, PDB: 1XRC
 
Genetics
Gene MG_047 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MAIRIKSTRVGRFVSESVGLGHPDKICDQIADSILDQCLLQSKTSHVACE
VFASKNLILIGGEISTSGYVDVVQTAWRILRNLGYNETDFSFLSCINNQS
LEINQAVLKNNEINAGDQGITVGYAVNETKQLMPLGVLLAHSFLKQAEKL
TKQFDFLKNDMKSQVVLNYSLNQVECEEVLLSIQHTNAISLTELRKVIEN
NVILPVLNQYGFQDKKPTCLVNPGGSFVLGGPMADTGLTGRKIIVDTYGP
YAHHGGGSFSGKDPSKVDRTGAYFARFIAKHIVSLGWASECEVSISWVFS
KPNPQSITVKCFNTNIQYDEVLINRVVNNYFNWSITKIIDKLKLLDFVKY
SDYAVYGHFGNDLSPWEQPTELDKLECLIKNFH*
50
100
150
200
250
300
350
384
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3004C1921N507O569S13
Molecular weight (pH 7.5; Da) 42722.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
47995
Instability index 28.89
Is stable True
Aliphatic index 96.90
GRAVY (25C, pH 7.0) -0.0930
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Complex subunit S-adenosylmethionine synthetase
[c]: (4) MG_047_MONOMERMG_047_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer [PUB_0006]. Coenzymes Interacts with 2 MG or CO per monomer as prosthetic group [96,386]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23