MG_046_MONOMER – metalloendopeptidase

Name
WID MG_046_MONOMER View in model
Name metalloendopeptidase View in model
 
Genetics
Gene MG_046 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MEQPLCVLGIETTCDDTGLSIVIDQKIKSNIVISSANLHVKTGGVVPEIA
ARCHEQNLFKAIRDLNFEIRDLSHIAYACNPGLAGCLHVGATFARSLSFL
LDKPLLPINHLYAHIFSCLIDQDLNKLQLPALGLVISGGHTAIYLVKSFY
ELELIAETSDDAIGEVYDKIGRAMGFDYPAGSKIDSLFNKELVKPHYFFK
PSTKWTKFSYSGLKSQCLNKIKQISANKTRIDWSELASNFQATIIDHYID
HVKNAIKKFAPKMLLVGGGVSANSYLSNRISTLNLPFLIADSKYTSDNGA
MIGFYASLLINGDKN*
50
100
150
200
250
300
316
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2475C1573N408O454S11
Molecular weight (pH 7.5; Da) 34718.56 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
29755
Instability index 39.05
Is stable True
Aliphatic index 103.45
GRAVY (25C, pH 7.0) 0.0611
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit metalloendopeptidase
[c]: (2) MG_046_MONOMERMG_046_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0006, PUB_0427]. S. typhimurium YeaZ forms dimer [PUB_0427]. Coenzymes Monomer interacts with Zn with unknown stoichiometry as prosthetic group [96].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

  2. Nichols CE, Johnson C, Lockyer M, Charles IG, Lamb HK, Hawkins AR, Stammers DK. Structural characterization of Salmonella typhimurium YeaZ, an M22 O-sialoglycoprotein endopeptidase homolog. Proteins 64, 111-23 (2006). WholeCell: PUB_0427, PubMed: 16617437

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23