MG_045_MONOMER – spermidine/putrescine (polyamine) ABC transporter, spermidine/putrescine binding protein, putative

Name
WID MG_045_MONOMER View in model
Name spermidine/putrescine (polyamine) ABC transporter, spermidine/putrescine binding protein, putative View in model
Cross references PDB: 1POT, PDB: 1POY
 
Genetics
Gene MG_045 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MKKQLKYCFFSLFVSLSSILSSCGSTTFVLANFESYISPLLLERVQEKHP
LTFLTYPSNEKLINGFANNTYSVAVASTYAVSELIERDLLSPIDWSQFNL
KKSSSSSDKVNNASDAKDLFIDSIKEISQQTKDSKNNELLHWAVPYFLQN
LVFVYRGEKISELEQENVSWTDVIKAIVKHKDRFNDNRLVFIDDARTIFS
LANIVNTNNNSADVNPKEDGIGYFTNVYESFQRLGLTKSNLDSIFVNSDS
NIVINELASGRRQGGIVYNGDAVYAALGGDLRDELSEEQIPDGNNFHIVQ
PKISPVALDLLVINKQQSNFQKEAHEIIFDLALDGADQTKEQLIKTDEEL
GTDDEDFYLKGAMQNFSYVNYVSPLKVISDPSTGIVSSKKNNAEMKSKQM
STDQMTSEKEFDYYTETLKALLEKEDSAELNENEKKLVETIKKAYTIEKD
SSIRWNQLVEKPISPLQRSNLSLSWLDFKLHWW
50
100
150
200
250
300
350
400
450
483
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 26 (nt) View in model
Empirical formula (pH 7.5) H3807C2456N636O776S7
Molecular weight (pH 7.5; Da) 54883.61 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
64080
Instability index 37.78
Is stable True
Aliphatic index 89.40
GRAVY (25C, pH 7.0) -0.422
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit spermidine/putrescine (polyamine) ABC transporter
(2) MG_042_MONOMER[c] + MG_043_MONOMER[m] + MG_044_MONOMER[m] + MG_045_MONOMER[e] ⇒ MG_042_043_044_045_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as heteropentamer (see MG_042_043_044_045_PENTAMER). Signal Peptipde Signal peptide of length 22 (SPdb321867, MKKQLKYCFFSLFVSLSSILSS) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23