MG_044_MONOMER – spermidine/putrescine (polyamine) ABC transporter, permease protein, putative

Name
WID MG_044_MONOMER View in model
Name spermidine/putrescine (polyamine) ABC transporter, permease protein, putative View in model
 
Genetics
Gene MG_044 View in model
 
Structure
Sequence
1
51
101
151
201
251
MKKHFKNLIKNSYFFLLITLIYLPLLIVVLVSLNGSSSRGNIVLDFGNVL
NPNPDSKSAYLRLGETDFATPLINSIIIGVITVLVSVPIAVISAFALLRT
RNALKKTIFGITNFSLATPDIITAISLVLLFANTWLSFNQQLGFFTIITS
HISFSVPYALILIYPKIQKLNPNLILASQDLGYSPLKTFFHITLPYLMPS
IFSAVLVVFATSFDDYVITSLVQGSVKTIATELYSFRKGIKAWAIAFGSI
LILISVLGVCLITLQKYLREKRKEIIKIRQWKNS*
50
100
150
200
250
285
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2402C1500N357O385S3
Molecular weight (pH 7.5; Da) 31693.38 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31525
Instability index 27.58
Is stable True
Aliphatic index 134.42
GRAVY (25C, pH 7.0) 0.692
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit spermidine/putrescine (polyamine) ABC transporter
(2) MG_042_MONOMER[c] + MG_043_MONOMER[m] + MG_044_MONOMER[m] + MG_045_MONOMER[e] ⇒ MG_042_043_044_045_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as heteropentamer (see MG_042_043_044_045_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:23