MG_042_MONOMER – spermidine/putrescine (polyamine) ABC transporter, ATP-binding protein, putative

Name
WID MG_042_MONOMER View in model
Name spermidine/putrescine (polyamine) ABC transporter, ATP-binding protein, putative View in model
 
Genetics
Gene MG_042 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
LNEHSLIEIEGLNKTFDDGYVSIRDISLNIKKGEFITILGPSGCGKTTLL
RLLAGFEDPTYGKIKVNGIDIKDMAIHKRPFATVFQDYALFSHLTVYKNI
AYGLKVMWTKLDEIPKLVSDYQKQLALKHLKLERKIEQLQKNNSNAQRIK
KLKEKLQKLLEINKQKVIEFENKEKLRREDIYKNLEQLTKEWDLLSQKKL
KEVEQQKQAIDKSFEKVENKYKKDPWFFQHSEIRLKQYQKKKTELKADIK
ATKNKEQIQKLTKELQTLKQKYANKKAIDKEYDKLVVAYNKKDYWTSYWE
TYTLQQKEAFEKRYLSRKLTKAEQNKKVSDVIEMVGLKGKEDRLPDELSG
GMKQRVALARSLVVEPEILLLDEPLSALDAKVRKNLQKELQQIHKKSGLT
FILVTHDQEEALVLSDRIVVMNEGNILQVGNPVDIYDSPKTEWIANFIGQ
ANIFKGTYLGEKKIQLQSGEIIQTDVDNNYVVGKQYKILIRPEDFDLVPE
NKGFFNVRVIDKNYKGLLWKITTQLKDNTIVDLESVNEVDVNKTFGVLFD
PIDVHLMEV*
50
100
150
200
250
300
350
400
450
500
550
560
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4778C2956N779O859S7
Molecular weight (pH 7.5; Da) 65198.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
69915
Instability index 39.51
Is stable True
Aliphatic index 97.61
GRAVY (25C, pH 7.0) -0.602
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit spermidine/putrescine (polyamine) ABC transporter
(2) MG_042_MONOMER[c] + MG_043_MONOMER[m] + MG_044_MONOMER[m] + MG_045_MONOMER[e] ⇒ MG_042_043_044_045_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as heteropentamer (see MG_042_043_044_045_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:22