MG_041_MONOMER – PTS system, HPr

Name
WID MG_041_MONOMER View in model
Name PTS system, HPr View in model
 
Genetics
Gene MG_041 View in model
 
Structure
Sequence
1
51
MKKFQAVIKDPVGIHARPASILASEASKFKSELKLVAPSGVEGNIKSIIN
LMSLGIRHNDNITIKADGADEEEALAAIKACLEKNKVI*
50
89
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H701C417N115O125S3
Molecular weight (pH 7.5; Da) 9421.89 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
125
Instability index 50.15
Is stable False
Aliphatic index 108.65
GRAVY (25C, pH 7.0) -0.00337
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit View in model
 
Comments
Comments Part of the heteropentamer PTS system (see MG_041_062_429_PENTAMER, MG_041_069_429_PENTAMER). May also regulate the transcription factor CcpA as a homohexamer.
 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:22