MG_040_MONOMER – Monosaccharide (riboside/galactoside) ABC transporter, substrate binding protein

Name
WID MG_040_MONOMER View in model
Name Monosaccharide (riboside/galactoside) ABC transporter, substrate binding protein View in model
 
Genetics
Gene MG_040 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MGKLLFGKLVFKKSLFLLSGMSSLAVFLTACGATKIFDSSVQLLVSDNFS
TLADKSFSQMSYEGIRSFFKKSKGVDLPEADSSQLQEGNGLWKRPGFTLS
DRIATFNNIKNDGSDVIVATGFNQQESLQAITSDDIRFQSDKESLAKTGF
IFVDGAIEKEFNKRNGVPQFKSTPTNISSVAFRSDDGSFLTGVATAVYLN
LNQEYFLDKSGWSTNSSNNNELTVSGFVGIALPSTLSFLNGFRLGIAYFN
EVIYKHLSDAQDSSAQVTTSKQTVLKQLQVANGEKRIKKIKWISPKQGSD
GETINIQDHQSGSFSDTEPRAITIANNLIDKGVNAIIPIAGPQTNLVVTQ
IARRQAHTAVIGVDSAQELLDINIDAPNKDKLKMGNKKIIPFSSIKALDV
AVESILSTLEKGSSQNGYQGFGYNNIGTVKNNSVGVSEAGYEFLIDPVFW
KNTSSMQAMSLSASLKANAASSSDNKKKLSEVATKKNENGSTKNGSNDII
DKYAKLLTKSSSSTSMRNGSSDSNQQNFKTTDNDGDWTIVGDELGKYKSS
ELPIFTGSSSYPTFQTEAQNVLDGGANVASTQGFKWSFKQI*
50
100
150
200
250
300
350
400
450
500
550
592
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 33 (nt) View in model
Empirical formula (pH 7.5) H4473C2830N764O911S8
Molecular weight (pH 7.5; Da) 64031.71 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
49515
Instability index 33.83
Is stable True
Aliphatic index 78.92
GRAVY (25C, pH 7.0) -0.345
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit Monosaccharide (riboside/galactoside) ABC transporter
MG_040_MONOMER[e] + (2) MG_119_MONOMER[c] + MG_120_MONOMER[m] + MG_121_MONOMER[m] ⇒ MG_040_119_120_121_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as heteropentamer (see MG_040_119_120_121_PENTAMER). Signal Peptipde Signal peptide of length 30 (SPdb321803, MGKLLFGKLVFKKSLFLLSGMSSLAVFLTA) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:45
Last updated 2012-10-01 15:14:22