MG_039_MONOMER – FAD-dependent glycerol-3-phosphate dehydrogenase, putative

Name
WID MG_039_MONOMER View in model
Name FAD-dependent glycerol-3-phosphate dehydrogenase, putative View in model
 
Genetics
Gene MG_039 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MQTIDVLIVGGGVIGTSCAYELSQYKLKVALLEKNAFLGCETSQANSGVI
HSGIDPNPNKLTAKYNILGRKIWIEDWFKKLIFPRKKIATLIVAFNNEEK
LQLNLLKERGIKNSIPVENIQILDQQQTLLQEPFINPNVVASLKVEGSWL
IDPLIATKCLALASLQNNVAIYSNKKVTKIEIDSDDDFLVFINNETTPQF
KTKKLIDAAGHYADWLAETTQVDNFKQTTRKGQYLVLKNQNNLKINTIIF
MVPTIHGKGVVVAEMLDGNILVGPNAVEGIEKNKTRSIDLDSINQIKTIG
KKMVPSLQFENSIYSFAGSRAIDIETNDFVIRTAKSNPNFIILGGMKSPG
LTSSPAIAKRAVELLNLKLKKKINWNPNYNLSWI*
50
100
150
200
250
300
350
385
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3138C1938N510O561S8
Molecular weight (pH 7.5; Da) 42815.13 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
45295
Instability index 32.41
Is stable True
Aliphatic index 107.38
GRAVY (25C, pH 7.0) -0.110
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit FAD-dependent glycerol-3-phosphate dehydrogenase, putative
[c]: (2) MG_039_MONOMERMG_039_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:22