MG_037_MONOMER – nicotinate phosphoribosyltransferase

Name
WID MG_037_MONOMER View in model
Name nicotinate phosphoribosyltransferase View in model
 
Genetics
Gene MG_037 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MMDKRTSEIEFHLKNLLACDAYKLSHRLMYPQDTQNLYSMLTARGVYGDF
KEFVWNHDFAKEILLNVFNGFVNSVIEVKKNKLLAAALTDKLVSVFNDHE
LANEFTQHICHLASFLEKNKKMPLVAKIHESDQSLPFRTPLITIEGVENI
PNNFVWLVNYFETVLLENIWLFQTASTVAKRIKSLLEKYAKETADETSFI
NFQCHDFSMRGMSSLQSALYVARAHLQYFTGSDTILGGDNSRSILASEHS
VMCADGSKHELKTFQRLLEKFKDKKLSLVIDSYDMWNVLDNIIPRLKNLI
LMRGATLYLRADSGNYQTLICNPNYKKQDKSTWAMIDYLDHHFSSTINKK
GYKVLNKKIGIIYGDGITYQKIEWILNCLKNHGYCSSNIIFGVGSSTYQN
LNRDTLGFVYKLTAIKRNNRWIGVKKTPITDLSKSSKGGRYKTKRLITVY
*
50
100
150
200
250
300
350
400
450
451
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3684C2344N623O666S18
Molecular weight (pH 7.5; Da) 51825.13 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
70665
Instability index 36.15
Is stable True
Aliphatic index 91.66
GRAVY (25C, pH 7.0) -0.271
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme nicotinic acid mononucleotide pyrophosphorylase
[c]: ATP + (3) H + H2O + NAC + PRPPADP + NAMN + PI + PPI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0343].
References
  1. Eds Schomburg D, Schomburg I, Chang A. Nicotinate phosphoribosyltransferase. Springer Berlin, Heidelberg 137-145 (2007). WholeCell: PUB_0343, ISBN: 9783540497530

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:22