MG_036_MONOMER – aspartyl-tRNA synthetase

Name
WID MG_036_MONOMER View in model
Name aspartyl-tRNA synthetase View in model
Cross references PDB: 1IL2
 
Genetics
Gene MG_036 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MCFNQRILIGSISTEQLNKTIVIIGWIKRIKKLGEINFIIVGDKSGTIQV
TCKDKEQIQQLTREDIVIVKAKLQRLDSVRFELINPTIKLFSKSKTPPLI
IEDETDALEEVRLKYRYLDLRRRLMQKRLLLRHQFILAIRNWFNQQGFIE
IETPTLSKSTPEGAQDFLVPARIRKDCFYALVQSPQIYKQLLMIAGVEKY
FQIARVYRDEDSRKDRQPEHTQIDFEISFCNQKMIMNLVEKLFFSVFLDV
FQIKIKKTFPVFKFSELFERFGSDKPDLRYGFEIKDFTSLFQDHQNQFTK
LIEAKGIIGGIELTNIELSTDKIKALRKIAKDHDVSLEVHNKNNSTLKTS
IKCDEKNTLLLVANKSKKKAWTALGAIRNELKYHLDIVKPNQYSFCWVVD
FPLYDFDEKTNQWISNHNIFSKPKQEWIDNFESNKNEALSEQFDLVLNGF
EIGSGSIRINDPIVQKRLMNSLNIDPNKFAFLLEAYQYGAPVHGGMGLGI
DRLMMILNQTDNIREVIAFPKNNHGIEVHTNAPDKIDKEEVKWWIKELVK
*
50
100
150
200
250
300
350
400
450
500
550
551
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4633C2920N777O822S15
Molecular weight (pH 7.5; Da) 64256.53 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
62630
Instability index 34.41
Is stable True
Aliphatic index 97.11
GRAVY (25C, pH 7.0) -0.350
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit aspartyl-tRNA synthetase
[c]: (2) MG_036_MONOMERMG_036_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:22