MG_030_MONOMER – uracil phosphoribosyltransferase

Name
WID MG_030_MONOMER View in model
Name uracil phosphoribosyltransferase View in model
 
Genetics
Gene MG_030 View in model
 
Structure
Sequence
1
51
101
151
201
VIKKVQHALILNELTKLRDKNTTTSQFRMALNQITSLLFFEATKQLPLAT
VEVETPFAKTKGYKLKNDIVLVPIMRAGLGMIDAIVRYSDKIRVGHLGIY
RQTQTTSVISYYKKMPENISDSHVIILDPMLATGTTLLTAIKSIKEDKPI
KISVIAIVAAPEGINKVEKMHPHVDIFLAAIDEKLNDNRYIIPGLGDAGD
RLFGTK*
50
100
150
200
207
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1715C1039N274O295S6
Molecular weight (pH 7.5; Da) 22957.71 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
8940
Instability index 19.29
Is stable True
Aliphatic index 111.64
GRAVY (25C, pH 7.0) 0.0174
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit uracil phosphoribosyltransferase
[c]: (3) MG_030_MONOMERMG_030_TRIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotrimer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [96].
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:22