MG_029_MONOMER – DJ-1/PfpI family protein

Name
WID MG_029_MONOMER View in model
Name DJ-1/PfpI family protein View in model
 
Genetics
Gene MG_029 View in model
 
Structure
Sequence
1
51
101
151
MKKILVIVYPEMNDVEYTNVMVVFSFIKTIQTTCYHHSLKKITASNGVVE
VNNIVNTINLSEFDAVYIPGGIGATKHLDKDEKLLKTINYFKVNNLYLFA
ICDTPNVLFKHGIITKDEIYSSFPNPNLVMSENRSTAKVTVANKLITARS
AGCALEFATVIVCTFLKDNTLNELVHKRLFGSEIKD*
50
100
150
187
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1508C947N240O274S8
Molecular weight (pH 7.5; Da) 20896.01 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10930
Instability index 23.13
Is stable True
Aliphatic index 103.64
GRAVY (25C, pH 7.0) 0.106
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DJ-1/PfpI family protein
[c]: (2) MG_029_MONOMERMG_029_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0110].
References
  1. Chen J, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler-Bauer A, Marchler GH, Mazumder R, Nikolskaya AN, Rao BS, Panchenko AR, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, Bryant SH. MMDB: Entrez's 3D-structure database. Nucleic Acids Res 31, 474-7 (2003). WholeCell: PUB_0110, PubMed: 12520055, URL: http://www.ncbi.nlm.nih.gov/Structure/

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:22