MG_028_MONOMER

Name
WID MG_028_MONOMER View in model
 
Genetics
Gene MG_028 View in model
 
Structure
Sequence
1
51
101
151
201
MKRNWRQHYNVFLANLVLVFGFALNILVAKQSLNNTTPQFRFLFVTPFLG
VVIGAVLYFFDVKWFLIDYPYKKFHFQKKWAIVYLSGVIVFFLNVLIGVV
LLVVMVNYITNQILEREYERLFTNSLPYLWSTTGTSIVLSLISIGMSKTA
HFFIDIEILKAKKGEPTDPNKTDNRAVVINLDENKKNEKEQSPPSAEMTS
L*
50
100
150
200
202
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1693C1096N265O284S4
Molecular weight (pH 7.5; Da) 23253.97 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
33920
Instability index 34.16
Is stable True
Aliphatic index 109.90
GRAVY (25C, pH 7.0) 0.248
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21