MG_027_MONOMER – transcription termination/antitermination protein NusB

Name
WID MG_027_MONOMER View in model
Name transcription termination/antitermination protein NusB View in model
Cross references PDB: 1EY1, PDB: 1Q8C
 
Genetics
Gene MG_027 View in model
 
Structure
Sequence
1
51
101
151
MAITVKGLTNKLTRTQRRIAVVEFIFSLLFFLPKEAEVIQADFLEYDTKE
RQLNEWQKLIVKAFSENIFSFQKKIEEQQLKNQLEIQTKYNKISGKKIDL
LTTAVVLCALSEQKAHNTDKPLLISEALLIMDHYSQGAEKKQTHALLDKL
L*
50
100
150
152
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1293C796N206O228S3
Molecular weight (pH 7.5; Da) 17493.17 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10095
Instability index 31.46
Is stable True
Aliphatic index 107.83
GRAVY (25C, pH 7.0) -0.221
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Liu et al crystallized MG_027 and showed that it is a structural homolog of N-utilizing substance B (Nusb) proteins [PUB_0815]. E. coli solution structure suggests NusB is functional as monomer [PUB_0322, PUB_0815]; Mycobacterium tuberculosis structure suggests NusB is functional as a homodimer.
References
  1. Bonin I, Robelek R, Benecke H, Urlaub H, Bacher A, Richter G, Wahl MC. Crystal structures of the antitermination factor NusB from Thermotoga maritima and implications for RNA binding. Biochem J 383, 419-28 (2004). WholeCell: PUB_0322, PubMed: 15279620

  2. Liu J, Yokota H, Kim R, Kim SH. A conserved hypothetical protein from Mycoplasma genitalium shows structural homology to nusb proteins. Proteins 55, 1082-6 (2004). WholeCell: PUB_0815, PubMed: 15146506

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21