MG_026_MONOMER – translation elongation factor P

Name
WID MG_026_MONOMER View in model
Name translation elongation factor P View in model
 
Genetics
Gene MG_026 View in model
 
Structure
Sequence
1
51
101
151
MAEMIEAKNLRNGQTIFGPNKEILLVLENTFNKTAMRQGIVKTKVKNLRT
GAIVWLEFTGDKLEQVIIDKKKMNFLYKDGNNFVFMDQKDYSQIEINEKK
LEWEKNFITEEIEVTVITYQDEILGVNLPDLVPIEVEFAEDAIQGNTANM
ARKKARLVTGYELDVPQFINTGDKIVIATVDGNYRERFNK*
50
100
150
191
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1565C985N257O295S6
Molecular weight (pH 7.5; Da) 21919.84 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
18450
Instability index 28.62
Is stable True
Aliphatic index 93.35
GRAVY (25C, pH 7.0) -0.380
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0341].
References
  1. Hanawa-Suetsugu K, Sekine S, Sakai H, Hori-Takemoto C, Terada T, Unzai S, Tame JR, Kuramitsu S, Shirouzu M, Yokoyama S. Crystal structure of elongation factor P from Thermus thermophilus HB8. Proc Natl Acad Sci U S A 101, 9595-600 (2004). WholeCell: PUB_0341, PubMed: 15210970

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21