MG_025_MONOMER – Beta-glycosyl transferase

Name
WID MG_025_MONOMER View in model
Name Beta-glycosyl transferase View in model
 
Genetics
Gene MG_025 View in model
 
Structure
Sequence
1
51
101
151
201
251
VPSKYLFTVIIPTYNCCQYIKKALDSLLLQNEYFLKTQVLIVNDGSLDNT
KEVVSDYLIKYSNISYFEKTNGNWGSVINYVKKNKLALGQYITVLDSDDY
FLKDSFKKVARFFGHDMIIGAFYCYINENKTRFLKPYFGKTGVIKEHTKL
RTPHSQPIAKFYSNKLFYELHDLKEKLFFQDCLMYHDAINRVESVFYLRE
PLAVWFSTRPGNSTTTSWENPNKFNAWCEILQKMNLYGAGIVIYIYTMLP
GFLKQLKKKQLILNLNHKPAYTWLPKPLAFIFGGLMAFKTRKYIKYPK*
50
100
150
200
250
299
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2513C1643N399O429S10
Molecular weight (pH 7.5; Da) 35039.50 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
62395
Instability index 26.00
Is stable True
Aliphatic index 89.00
GRAVY (25C, pH 7.0) -0.216
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21