MG_024_MONOMER – GTP-binding protein YchF

Name
WID MG_024_MONOMER View in model
Name GTP-binding protein YchF View in model
 
Genetics
Gene MG_024 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MLSAGIVGLPNVGKSTLFSAITNLQVEIANYPFATIEPNTGIVNVSDERL
DKLASLINPEKIVYTTFRFVDIAGLVKGASQGQGLGNQFLANIREVDLIC
HVVRCFQDKKIVHVNNTIDPVFDFEIIVNELIQADFELITNRIGKLKRKA
ESGDKIAKEEFVLLEIVLNGLKQGQMPIQTLSESELKTIKSLNLLTAKPI
LIVANVSENDLLNLDNNEALKKLNAFLDQKKIPKAITVCSLIEKELSGLK
LEQRQYFLDELGLKNYSGLNRVIQAAYQTLNLWSFFTFGKKEVRAWTFKK
GWNAPQCAGQIHSDFEKGFIKVEVISWDQLFAMKSLQEAKKQGLIRLEGK
NYLIKDGDVCNFKFNVT*
50
100
150
200
250
300
350
368
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3003C1872N488O538S8
Molecular weight (pH 7.5; Da) 41210.22 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31565
Instability index 17.90
Is stable True
Aliphatic index 108.34
GRAVY (25C, pH 7.0) -0.0465
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group [215].
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21