MG_023_MONOMER – fructose-1,6-bisphosphate aldolase, class II

Name
WID MG_023_MONOMER View in model
Name fructose-1,6-bisphosphate aldolase, class II View in model
Cross references PDB: 1GYN, PDB: 1ZEN
 
Genetics
Gene MG_023 View in model
 
Structure
Sequence
1
51
101
151
201
251
MLVNFKLMLQKAKLGKYAIPHININNYEWAKAVLTAANQANSPIIVSVSE
GALKYMSGYSVVIPLVKGLIESLSVKVPVTLHLDHGSYDACIQALQAGFS
SVMFDGSHLPFEENFNKSKKLIEIAQKTNASVELEVGTIGGEEDGVIGQG
ELANVDECKQIASLKPDALAAGIGNIHGIYPKNWKGLNFPLIETISKITN
LPLVLHGGSGILENDVKKAISLGICKLNINTECQLAFAHEIRKYIESNKD
LDLNKKGYDPRKLLKEPTQAIVDTCLEKIDLCGSRNKA*
50
100
150
200
250
289
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2268C1405N370O416S10
Molecular weight (pH 7.5; Da) 31319.83 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
23670
Instability index 38.03
Is stable True
Aliphatic index 106.99
GRAVY (25C, pH 7.0) -0.0329
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit fructose-1,6-bisphosphate aldolase, class II
[c]: (2) MG_023_MONOMERMG_023_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96,387].
 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21