MG_021_MONOMER – methionyl-tRNA synthetase

Name
WID MG_021_MONOMER View in model
Name methionyl-tRNA synthetase View in model
Cross references PDB: 1F4L, PDB: 1QQT
 
Genetics
Gene MG_021 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MKRCYITTPIYYASGKPHIGHAFTTILADVIKRFKIQNGYEAFLLVGSDE
HGNKIESKAKSLNLDPKTFVDINAQAFKLMWKTLNISFDHFIRTTDEIHK
QQVQKTFQDLYDKKLIYQSEWKGAYCVECEQNYFTFNKQTMLCEIGHNLS
LVQEPCWFISFSSTKNWIETTIGKNQLNIIPKSRASELKNNFINNGLNDL
ALTRKNVTWGIKVPFDPNQTIYVWFDALFSYITNLGFRNGDPNFIKWWNN
DNKEREVIHLISREITRFHCIYWPIFLHLLDIKLPTQFLSHGWIVDGEGR
KMSKSLNNVISPEQLIDQFGVDGTRYCLLKEMRLDKDNRCSVSILKEIYN
ADLANSFGNHVSRTFGMIKKYLNGKLEYQIITDNALQKIMILIDESIVQF
DHYFNSYEFYRAINLLLKIVFELSKLIDDFKPWELFKNQEFSLLKQLLFT
CVRCVQVCYVLLTPILVNTASKVFHLFNFADDACRKDQLRDATLLKKIII
SNSMEVLFKRVD*
50
100
150
200
250
300
350
400
450
500
513
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H4248C2750N710O758S20
Molecular weight (pH 7.5; Da) 60024.59 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
90310
Instability index 24.76
Is stable True
Aliphatic index 95.38
GRAVY (25C, pH 7.0) -0.196
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit methionyl-tRNA synthetase
[c]: (2) MG_021_MONOMERMG_021_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0006]. Coenzymes Interacts with 1 ZN per monomer as prosthetic group [96,386].
References
  1. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:44
Last updated 2012-10-01 15:14:21